DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and SLC9A3R2

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_016879383.1 Gene:SLC9A3R2 / 9351 HGNCID:11076 Length:372 Species:Homo sapiens


Alignment Length:163 Identity:61/163 - (37%)
Similarity:86/163 - (52%) Gaps:25/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STPTSPKTPTPPTLPP---GVT--------KTCHIVKRPDFDGYGFNLHSEKVKPGQFIGKVDAD 55
            :||.:.....||..||   .|:        :.||:.|.|  .||||||||:|.:|||:|..||..
Human   166 ATPPARAPGAPPRSPPQRLDVSGPLRELRPRLCHLRKGP--QGYGFNLHSDKSRPGQYIRSVDPG 228

  Fly    56 SPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIKAIANEVRLLLIDVDG----KALEVKPASP- 115
            |||..:||:..||::||||.::....|.:|||.|||..:|.|||::|.:.    |.|.|.|... 
Human   229 SPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVDPETDEHFKRLRVTPTEEH 293

  Fly   116 -----PAAACNGNGSASQNGYE--GTKQEMPGA 141
                 |:...||...|..||..  .::.::||:
Human   294 VEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 41/88 (47%)
SLC9A3R2XP_016879383.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157323
Domainoid 1 1.000 87 1.000 Domainoid score I8027
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D377274at33208
OrthoFinder 1 1.000 - - FOG0002256
OrthoInspector 1 1.000 - - otm40677
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2561
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.