DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and PDZD7

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001182192.1 Gene:PDZD7 / 79955 HGNCID:26257 Length:1033 Species:Homo sapiens


Alignment Length:228 Identity:54/228 - (23%)
Similarity:88/228 - (38%) Gaps:40/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TPTPPTLPPGVTKTCHIVKRPDFDGYGFNLHSEK-VKPGQFIGKVDADSPAEAAGLKEGDRILEV 72
            ||:..:...||.:..|:....|....|||:...| ...|.::.|||....||..|:|.||::|..
Human   197 TPSDTSSEDGVRRIVHLYTTSDDFCLGFNIRGGKEFGLGIYVSKVDHGGLAEENGIKVGDQVLAA 261

  Fly    73 NGVSIGSETHKQVVARIKAIANEVRLLLIDVDGKALEVKPASPPAAACNGNGSASQNGY-----E 132
            |||.....:|.|.|..:|...:  .:|.|...|:....|.            ..|:..:     .
Human   262 NGVRFDDISHSQAVEVLKGQTH--IMLTIKETGRYPAYKE------------MVSEYCWLDRLSN 312

  Fly   133 GTKQEMPGASANISSISMVSTKRSSNASSIQSGSTMNASDLDVV-------DRGIPAVAAPVAIT 190
            |..|::..||.:.||:|      |..:|:..|..::.:..:|:.       .||.....|..|:.
Human   313 GVLQQLSPASESSSSVS------SCASSAPYSSGSLPSDRMDICLGQEEPGSRGPGWGRADTAMQ 371

  Fly   191 PPPVQNGS-------KPSSPINNNTLMSTPPPP 216
            ..|...|.       :|:..:.:..:.|..|.|
Human   372 TEPDAGGRVETWCSVRPTVILRDTAIRSDGPHP 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 25/81 (31%)
PDZD7NP_001182192.1 PDZ_signaling 84..164 CDD:238492
PDZ_signaling 209..289 CDD:238492 25/81 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 323..380 13/62 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..464
HN_PDZD7_like 554..630 CDD:259824
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 754..864
PDZ_signaling 860..948 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 943..1033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.