DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and PDZD3

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_011541302.1 Gene:PDZD3 / 79849 HGNCID:19891 Length:571 Species:Homo sapiens


Alignment Length:278 Identity:71/278 - (25%)
Similarity:109/278 - (39%) Gaps:63/278 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PTLPPGVTKTCHIVKRPDFDGYGFNLHSEK---VKPGQFIGKVDADSPAEAAGLKEGDRILEVNG 74
            ||.|    :..|:.|.|  .|:||.|..||   .:||||:.:||...||:.||::.|||::.|.|
Human   324 PTKP----RCLHLEKGP--QGFGFLLREEKGLDGRPGQFLWEVDPGLPAKKAGMQAGDRLVAVAG 382

  Fly    75 VSIGSETHKQVVARIKAIANEVRLLLIDVDG-KALEVKPASPPAAACNGNGSASQNGYEGTKQEM 138
            .|:....|::.|:||:...:.|.|.::|.:. :...:...||.....|....||..|        
Human   383 ESVEGLGHEETVSRIQGQGSCVSLTVVDPEADRFFSMVRLSPLLFLENTEAPASPRG-------- 439

  Fly   139 PGASANISSISMVSTKRSSNASSIQSGSTMNASDLDVVDRGIPAVAAPVAITPPPVQNGSKPSSP 203
                             ||:||.:::      .|..:.|..:|:|  |:......:..|...|..
Human   440 -----------------SSSASLVET------EDPSLEDTSVPSV--PLGSRQCFLYPGPGGSYG 479

  Fly   204 INNNTLMSTP--------PPPSATKAGINNNGSVYNTNGNGTNGMT-------TPTTPPPPTSGY 253
            ...:.:.|.|        |..||.:||:.....:...||....|..       .|...||.....
Human   480 FRLSCVASGPRLFISQVTPGGSAARAGLQVGDVILEVNGYPVGGQNDLERLQQLPEAEPPLCLKL 544

  Fly   254 KAGTLH-----LPMTAAE 266
            .|.:|.     :|..|||
Human   545 AARSLRGLEAWIPPGAAE 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 31/83 (37%)
PDZD3XP_011541302.1 PDZ_signaling 113..193 CDD:238492
PDZ_signaling 221..298 CDD:238492
PDZ 326..411 CDD:214570 32/90 (36%)
PDZ_signaling 466..545 CDD:238492 15/78 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D377274at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40677
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.