DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Grip1

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_006514294.1 Gene:Grip1 / 74053 MGIID:1921303 Length:1185 Species:Mus musculus


Alignment Length:325 Identity:70/325 - (21%)
Similarity:120/325 - (36%) Gaps:76/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TKTCHIVKRPD-FDGYGFNLH-----SEKVKPGQFIGKVDADSPAEAAG-LKEGDRILEVNGVSI 77
            |:|..:|...| ..|:|..|.     :|.:.....|..::||||||..| |:.|||::.:||:..
Mouse   524 TETTEVVLTADPVTGFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPT 588

  Fly    78 GSETHKQV--VARIKAIANEVRL-LLIDVDGKALEVKPA--------------------SPPAAA 119
            ...|.::.  :.|..:|.::|.| :..||   |..|.|:                    |.|::.
Mouse   589 EDSTFEEANQLLRDSSITSKVTLEIEFDV---AESVIPSSGTFHVKLPKKHSVELGITISSPSSR 650

  Fly   120 CNGNGSASQNGYEGTKQEMPGASANISSISMVSTKRSSNAS---SIQ------------------ 163
            ..|:.....:..:|:.....|.......:..:...|..|.|   ::|                  
Mouse   651 KPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDED 715

  Fly   164 SGSTMNASDLDVVDRGIPAVAAPVAITPPPVQNGSKPSSPINNNTLMSTPPPPSATKAGI-NNNG 227
            :.....:|...:....:.....|:.||   :....:|..||    ::|     |.||.|: ...|
Mouse   716 NSDEQESSGAIIYTVELKRYGGPLGIT---ISGTEEPFDPI----IIS-----SLTKGGLAERTG 768

  Fly   228 SVYNTNGNGTNGMTTPTTPPPPTSGYKAGTLHLPMTAAEMRAKLASKKKYDPKNESVDLKKKFDI 292
            :::  .|:....:.:.:....|.|    ..:||...|.| ...|..||:.|.  :|....|||.|
Mouse   769 AIH--IGDRILAINSSSLKGKPLS----EAIHLLQMAGE-TVTLKIKKQTDA--QSASSPKKFPI 824

  Fly   293  292
            Mouse   825  824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 27/90 (30%)
Grip1XP_006514294.1 PDZ_signaling 110..190 CDD:238492
PDZ_signaling 209..292 CDD:238492
PDZ_signaling 307..390 CDD:238492
PDZ_signaling 526..614 CDD:238492 26/87 (30%)
PDZ_signaling 627..711 CDD:238492 9/83 (11%)
PDZ_signaling 727..808 CDD:238492 20/99 (20%)
PDZ_signaling 1058..1138 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.