DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Pard3b

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_006496361.1 Gene:Pard3b / 72823 MGIID:1919301 Length:1238 Species:Mus musculus


Alignment Length:406 Identity:78/406 - (19%)
Similarity:137/406 - (33%) Gaps:127/406 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTSP------------KTPTPPTLPP----GVTKTCHIVK---RPDFDGYGF-------NLHSEK 42
            |.||            :.|:.|:|.|    |..|....:|   :...:|.||       ::|.  
Mouse   379 PASPQQSKSPRVPRLGRKPSSPSLSPLMGFGSKKNAKKIKIDLKKGPEGLGFTVVTRDSSIHG-- 441

  Fly    43 VKPGQ-FIGKVDADSPAEAAG-LKEGDRILEVNGVSIGSETHKQVVARIKAI--ANEVRLLLIDV 103
              ||. |:..:.....|...| |:.|||||||||..:...|.:::||.:::.  ...|.|::...
Mouse   442 --PGPIFVKNILPKGAAVKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETVSLVIARQ 504

  Fly   104 DGKAL--EVKPASPPAAA--------------CNGNGSASQN-GYEGTKQEMPGASANISSISMV 151
            :|..|  |:| ..|...|              .|.:|||... ..:|.|....|....|...|::
Mouse   505 EGSFLPRELK-GEPDCYALSLESSEQLTLEIPLNDSGSAGLGVSLKGNKSRETGTDLGIFIKSII 568

  Fly   152 -----------------------STKRSSNASSIQS--------GSTMNASDLDVV---DRGIPA 182
                                   :....||..::::        |:......|.::   :|.:..
Mouse   569 HGGAAFKDGRLRMNDQLIAVNGETLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPLEE 633

  Fly   183 VAAPVAITPPPVQNGSK------------------------------PSSPINNNTLMSTPPPPS 217
            ::...|::.|..:|..:                              ||.....|.:..:|||..
Mouse   634 LSECGALSRPGFENCQEALSTSRRNDSSILYPFGTYSPQDKRKDLLLPSDGWAENEVPPSPPPHP 698

  Fly   218 ATKAGINNNGSVYNTNGNG------TNGMTTPTTPPPPTSGYKAG-TLHLPMTAAEMRAKLASKK 275
            |.:.|:.:.......:..|      .|..|......|.....||. ::.|.....:::: ||.::
Mouse   699 ALEWGLEDFSHSSGVDSTGYFPDQHVNFRTVTPVRQPELINLKASKSMDLVPDEGKVQS-LADRR 762

  Fly   276 KYDPKNE---SVDLKK 288
            ...|..:   ::.|||
Mouse   763 SDSPGKDFGPTLGLKK 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 26/94 (28%)
Pard3bXP_006496361.1 DUF3534 2..74 CDD:338230
PDZ_signaling 236..323 CDD:238492
PDZ 415..504 CDD:214570 25/92 (27%)
PDZ_signaling 536..624 CDD:238492 13/87 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.