DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10939 and Ush1c

DIOPT Version :9

Sequence 1:	NP_524712.1	Gene:	CG10939 / 44155	FlyBaseID:	FBgn0010620	Length:	296	Species:	Drosophila melanogaster
Sequence 2:	NP_710143.2	Gene:	Ush1c / 72088	MGIID:	1919338	Length:	910	Species:	Mus musculus

Alignment Length:	60	Identity:	22/60 - (36%)
Similarity:	35/60 - (58%)	Gaps:	1/60 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    33 GYGFNLHSEKV-KPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIKA 91
            |.|.::.|..: |||.|:..|...|.:...||:.||:|:||||:...:..||:.|..:|:
Mouse   221 GLGCSISSGPIQKPGIFVSHVKPGSLSAEVGLETGDQIVEVNGIDFTNLDHKEAVNVLKS 280

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10939	NP_524712.1	PDZ_signaling	20..101	CDD:238492	22/60 (37%)
Ush1c	NP_710143.2	N-terminal domain. /evidence=ECO:0000250\|UniProtKB:Q9Y6N9	1..86
		harmonin_N	2..80	CDD:259819
		PDZ_signaling	85..165	CDD:238492
		Mediates interaction with MYO7B. /evidence=ECO:0000250\|UniProtKB:Q9Y6N9	194..833		22/60 (37%)
		PDZ_signaling	209..289	CDD:238492	22/60 (37%)
		Cgr1	<309..>358	CDD:281823
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	563..688
		PDZ_signaling	751..838	CDD:238492
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	890..910
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900