DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Dlg5

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_017171686.1 Gene:Dlg5 / 71228 MGIID:1918478 Length:1931 Species:Mus musculus


Alignment Length:322 Identity:74/322 - (22%)
Similarity:125/322 - (38%) Gaps:82/322 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPTSPKTPTPPTLP----------------PGVTKTCHIVKRPDFDGYGFNLHSEKVKPGQFI 49
            :|:.:.|:| |..|||                |.|.:..|:..:...:..|.::.|.: |.|.::
Mouse  1322 LSSCSQPQT-TASTLPRIAVNPSSHGERRKDRPFVEEPRHVKVQKGSEPLGISIVSGE-KGGVYV 1384

  Fly    50 GKVDADSPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIKAIANEVRLLLIDVDGKALEVKPAS 114
            .||...|.|..|||:.||::||.||:::.|.|.:|           .||::              
Mouse  1385 SKVTLGSIAHQAGLEYGDQLLEFNGINLRSATEQQ-----------ARLII-------------- 1424

  Fly   115 PPAAACNGNGSASQNGYEGTKQEMPGASANISSISMVSTKRSSNASSIQSGSTMNASDLDVV--- 176
              ...|:.....:|  |.....::...|.:.|.:...:|..|:...| .:|:..:.|.:|.:   
Mouse  1425 --GQQCDTITILAQ--YNPHIHQLNSHSRSSSHLDPAATPHSTLQGS-SAGTPEHPSVIDPLMEQ 1484

  Fly   177 DRGIPAVAAPVAITPPPVQNGSKPSSPINNNTLMSTPPP------PSATKAGINNNGSVYNTNGN 235
            |.| |.       |||..|:.|...|.  .:|...||.|      .|....|::..|      ||
Mouse  1485 DEG-PG-------TPPAKQSASSTRSV--GDTTKKTPDPRIVFIKKSQLDLGVHLCG------GN 1533

  Fly   236 GTNGM----TTPTTPPPPTSGYKAGTLHLPMTAAEMRAKLASK---KKYDPKNESVDLKKKF 290
             .:|:    ....:|.....|...|.|.|...:.:||::....   :...|| :|:.||.::
Mouse  1534 -LHGVFVAEVEDDSPAKGPDGLVPGDLILEYGSLDMRSRTVEDVYVEMLKPK-DSLRLKVQY 1593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 23/80 (29%)
Dlg5XP_017171686.1 Takusan 129..213 CDD:368141
Smc <141..564 CDD:224117
PDZ_signaling 625..712 CDD:238492
PDZ_signaling <741..800 CDD:238492
PDZ 1357..1439 CDD:214570 26/111 (23%)
dbPDZ_assoc 1437..1512 CDD:374667 20/85 (24%)
PDZ 1513..1594 CDD:214570 19/89 (21%)
SH3_DLG5 1610..1672 CDD:212794
GuKc 1744..1920 CDD:214504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.