DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Pdzd2

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_038959013.1 Gene:Pdzd2 / 65034 RGDID:619958 Length:2818 Species:Rattus norvegicus


Alignment Length:311 Identity:64/311 - (20%)
Similarity:100/311 - (32%) Gaps:90/311 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GVTKTCHIVK------------------RPDF-----------DGYGFNLHSE----KVKPGQFI 49
            |.::..||||                  ||..           .|.||::...    :.:.|.|:
  Rat   553 GTSQEYHIVKKSTRSLSTTHVESPWRLIRPSVISIIGLYKEKGKGLGFSIAGGRDCIRGQMGIFV 617

  Fly    50 GKVDAD-SPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIKAIANEVRLLLIDVDGKALEVKPA 113
            ..:..: |.||...|||||.||:|||:.|...|.::.:...|.|.:.:.:|.:.....:..:.|.
  Rat   618 KTIFPNGSAAEDGRLKEGDEILDVNGIPIKGLTFQEAIHTFKQIRSGLFVLTVRTKLLSPSLTPC 682

  Fly   114 SPPAAACNGNGSASQNGYEGTK----QEMPGASANISSISMVSTKRSSNASSIQSGSTMNASDLD 174
            |.|......:..:......||.    ||..|:|:       :..|.......|....|:|.... 
  Rat   683 STPTHMSRSSSPSFNTNSGGTPAGGGQEEGGSSS-------LGRKAPGPKDRIVMEVTLNKEPR- 739

  Fly   175 VVDRGIPAVAAPVAITPPPV--------------QNGSKPSSPINNNT--------------LMS 211
             |..||.|....:..:||.:              .|.|:....:..|:              |..
  Rat   740 -VGLGIGACCLALENSPPGIYIHSLAPGSVAKMESNLSRGDQILEVNSVNVRHAALSKVHAILSK 803

  Fly   212 TPPPPSATKAGINNNGSV---------------YNTNGNGTNGMTTPTTPP 247
            .||.|.....|.:.|..|               .:...|.:.|:.||...|
  Rat   804 CPPGPVRLVIGRHPNPKVSEQEMDEVIARSTYQESREANSSPGLGTPLKSP 854

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 29/114 (25%)
Pdzd2XP_038959013.1 PDZ_signaling 335..416 CDD:238492
PDZ_signaling 590..671 CDD:238492 23/80 (29%)
PDZ_signaling 729..813 CDD:238492 15/85 (18%)
PHA03247 <985..1446 CDD:223021
PDZ_signaling 2603..2677 CDD:238492
PDZ_signaling 2731..2813 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.