DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Pdzk1

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001139473.1 Gene:Pdzk1 / 59020 MGIID:1928901 Length:519 Species:Mus musculus


Alignment Length:277 Identity:67/277 - (24%)
Similarity:106/277 - (38%) Gaps:59/277 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KTCHIVKRPDFDGYGFNLHSEKVKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIGSETHKQV 85
            :.|.:.|: :...|||.|..||...|..|..::..||||.|||.:|||:|.:|||.:..|.|.||
Mouse     8 RECKLSKQ-EGQNYGFFLRIEKDTDGHLIRVIEEGSPAEKAGLLDGDRVLRINGVFVDKEEHAQV 71

  Fly    86 VARIKAIANEVRLLLIDVDGKALEVK--------PASPPAAACNGNGSASQNGYEGTKQEMPGAS 142
            |..::...|.|.||::|.|.....||        ..|...||.|              .:.||..
Mouse    72 VELVRKSGNSVTLLVLDGDSYEKAVKNQVDLKELDQSQREAALN--------------DKKPGPG 122

  Fly   143 ANISSISMVSTKRSSNASSIQSGSTMNASDLDVVD--RGIPAVAAPVAITPPPVQNGSKPSSPIN 205
            .| .::...:..|.  ...::.|::...| |..:.  :|:                         
Mouse   123 MN-GAVEPCAQPRL--CYLVKEGNSFGFS-LKTIQGKKGV------------------------- 158

  Fly   206 NNTLMSTPPPPSATKAGINNNGSVYNTNGNGTNGMTTPTTPPPPTSGYKAGTLHLPMTAAEMRAK 270
              .|.:..|...|.|||:..:..:...||......:........|   |:|:..:.:...:..|:
Mouse   159 --YLTNIMPQGVAMKAGVLADDHLIEVNGENVENASHEEVVEKVT---KSGSRIMFLLVDKETAR 218

  Fly   271 LASKKKYDPKNESVDLK 287
            ..|::|...|.|:..||
Mouse   219 CHSEQKTQFKRETASLK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 33/79 (42%)
Pdzk1NP_001139473.1 PDZ_signaling 7..87 CDD:238492 33/79 (42%)
PDZ 132..212 CDD:214570 16/112 (14%)
PDZ_signaling 242..320 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..374
PDZ_signaling 376..455 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 479..519
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42750
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.