DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and dlg5a

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_005156738.1 Gene:dlg5a / 569065 ZFINID:ZDB-GENE-030131-3149 Length:1961 Species:Danio rerio


Alignment Length:253 Identity:55/253 - (21%)
Similarity:91/253 - (35%) Gaps:79/253 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TSPKTPTPP---------------------TLP----------------PGVTKTCHIVKRPDFD 32
            :||...|||                     |||                |.:.:..:::.....:
Zfish  1328 SSPSLITPPLSPLNLETSSFASSQSQGSISTLPRISVSPVPTEERRKDRPYLEEPRNVMVHKGAE 1392

  Fly    33 GYGFNLHSEKVKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIKAIANEVR 97
            ..|.::.|.: ..|.|:.||...|.|..|||:.||::||.||:::.:.|.:|  ||         
Zfish  1393 PLGISIVSGE-NGGIFVSKVTGGSIAHQAGLEYGDQLLEYNGINLRNATEQQ--AR--------- 1445

  Fly    98 LLLIDVDGKALEVKPASPPAAACNGNGSASQNGYEGTKQEMPGASANISSISMVSTKRSSNASSI 162
             |:|......:.:.....|.....||.|.|              |:.:..:|..||.:.|..::.
Zfish  1446 -LIIGQQCDTITIMAQYNPHMYQLGNHSRS--------------SSRLEPVSTQSTPQGSGTATP 1495

  Fly   163 QSGSTMNASDLDVVDRGIPAVAAPVAITPPPVQNGSKPSSPINNNTLMSTPPPPSATK 220
            .:.||::.  |...|.|        .:||     .||.::|..:.......|..|:.|
Zfish  1496 DNHSTIDT--LSEQDEG--------TLTP-----SSKQTTPTTSPNSFIRMPSESSKK 1538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 22/80 (28%)
dlg5aXP_005156738.1 CARD 9..88 CDD:260018
Takusan 128..211 CDD:282652
Taxilin 295..627 CDD:286771
RILP-like 338..460 CDD:304877
SH3BP5 444..648 CDD:283045
PDZ_signaling 696..783 CDD:238492
PDZ_signaling 793..866 CDD:238492
PDZ 1381..1463 CDD:214570 23/94 (24%)
dbPDZ_assoc 1461..1541 CDD:293216 23/107 (21%)
PDZ 1541..1623 CDD:214570
SH3_DLG5 1639..1701 CDD:212794
Guanylate_kin 1780..1949 CDD:279019
NK 1794..1950 CDD:302627
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.