Sequence 1: | NP_524712.1 | Gene: | CG10939 / 44155 | FlyBaseID: | FBgn0010620 | Length: | 296 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005156738.1 | Gene: | dlg5a / 569065 | ZFINID: | ZDB-GENE-030131-3149 | Length: | 1961 | Species: | Danio rerio |
Alignment Length: | 253 | Identity: | 55/253 - (21%) |
---|---|---|---|
Similarity: | 91/253 - (35%) | Gaps: | 79/253 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 TSPKTPTPP---------------------TLP----------------PGVTKTCHIVKRPDFD 32
Fly 33 GYGFNLHSEKVKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIKAIANEVR 97
Fly 98 LLLIDVDGKALEVKPASPPAAACNGNGSASQNGYEGTKQEMPGASANISSISMVSTKRSSNASSI 162
Fly 163 QSGSTMNASDLDVVDRGIPAVAAPVAITPPPVQNGSKPSSPINNNTLMSTPPPPSATK 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10939 | NP_524712.1 | PDZ_signaling | 20..101 | CDD:238492 | 22/80 (28%) |
dlg5a | XP_005156738.1 | CARD | 9..88 | CDD:260018 | |
Takusan | 128..211 | CDD:282652 | |||
Taxilin | 295..627 | CDD:286771 | |||
RILP-like | 338..460 | CDD:304877 | |||
SH3BP5 | 444..648 | CDD:283045 | |||
PDZ_signaling | 696..783 | CDD:238492 | |||
PDZ_signaling | 793..866 | CDD:238492 | |||
PDZ | 1381..1463 | CDD:214570 | 23/94 (24%) | ||
dbPDZ_assoc | 1461..1541 | CDD:293216 | 23/107 (21%) | ||
PDZ | 1541..1623 | CDD:214570 | |||
SH3_DLG5 | 1639..1701 | CDD:212794 | |||
Guanylate_kin | 1780..1949 | CDD:279019 | |||
NK | 1794..1950 | CDD:302627 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |