DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and pdzd3b

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001124259.1 Gene:pdzd3b / 566852 ZFINID:ZDB-GENE-081022-151 Length:524 Species:Danio rerio


Alignment Length:174 Identity:51/174 - (29%)
Similarity:84/174 - (48%) Gaps:38/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTSPKTPTPPTLP-------PGVTKTCHIVKRPDFDGYGFNLHSEKVKPGQFIGKVDADSPAEAA 61
            |.:||...||..|       |.| :.| |::|.. .|:||:|...:.|||.||.:|.|.||.:::
Zfish   372 PVTPKPAVPPVEPQEEVQINPNV-RRC-ILERSS-AGFGFHLGCVQQKPGTFISQVAAGSPGQSS 433

  Fly    62 GLKEGDRILEVNGVSIGSETHKQVVARIKAIANEVRLLLIDVDGKALEVKPASPPAAACNGNGSA 126
            ||.:||.::||||.::..|:.:.|:..:|.....:.||::|                        
Zfish   434 GLFQGDVVVEVNGQNVEKESLEDVIMHVKRGGETLSLLVVD------------------------ 474

  Fly   127 SQNGYEGTKQEMPGASAN-ISSISMVSTKRSSNASS--IQSGST 167
             |.||:..||.....:.| :.:||.|....||:|.:  :::|.:
Zfish   475 -QKGYDWLKQNGKPVTLNKLETISEVEESVSSSAETARVKTGDS 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 29/80 (36%)
pdzd3bNP_001124259.1 PDZ_signaling 44..118 CDD:238492
PDZ 148..227 CDD:214570
PDZ_signaling 264..336 CDD:238492
PDZ 393..473 CDD:214570 30/82 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D377274at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.