DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and lnx2b

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_998105.2 Gene:lnx2b / 564464 ZFINID:ZDB-GENE-040426-2500 Length:678 Species:Danio rerio


Alignment Length:313 Identity:69/313 - (22%)
Similarity:101/313 - (32%) Gaps:106/313 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPTSPKTPTPPTLPPGVTKT---CHIV---------KRPDFDGYGFNLHSEKVKP-GQF-IGK 51
            :|.|:.|.. ..|....|...|   |.:|         :....:..|..:...|..| |.. |.:
Zfish   178 LSAPSEPGL-VNPAFEEGEDDTPLRCSLVAEATVVELFREDPGEDLGLRIVGGKDTPLGNIVIQE 241

  Fly    52 VDADSPAEAAG-LKEGDRILEVNGVSIGSETHKQVVARIKAIANEVRLLLIDVDGKALEVKP--- 112
            :..||.....| |..||.|||||.||:.|.:|.:.:|.|:...:.:||.::...|    .||   
Zfish   242 IVRDSLVARDGKLAPGDHILEVNDVSLASISHSRAIAVIRQPCSRLRLTVMQEKG----FKPRPE 302

  Fly   113 ------ASPPAAACNGNGSASQNGYEGTKQEMPGASANISSISMVSTKRSS--NASSIQSGSTMN 169
                  ||||..      |.|.|...||          :..:::|..:||.  ....|:......
Zfish   303 HHTQPSASPPTQ------SPSTNQNHGT----------VIQVTLVKHERSEALGIKLIRKSEEPG 351

  Fly   170 ASDLDVVDRGIPAVAAPVAITPPPVQNGSKPSSPINNNTLMSTPPPPSATKAG-INNNGSVYNTN 233
            ...||::..|:                                     |.|.| :.||..|...|
Zfish   352 VFILDLLPGGL-------------------------------------AAKDGKLRNNDKVLGIN 379

  Fly   234 G----NGTNGMTTPTTPPPPTSGYKAGTLHLPMTAAEMRAKLASKKKYDPKNE 282
            |    :||           |.|..:.      :.|:|||......:..|...|
Zfish   380 GQDLRHGT-----------PESAAQI------IQASEMRVNFVVMRLQDVSEE 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 27/95 (28%)
lnx2bNP_998105.2 RING 46..82 CDD:214546
PDZ_signaling 210..291 CDD:238492 24/80 (30%)
PDZ_signaling 325..406 CDD:238492 23/134 (17%)
PDZ_signaling 451..537 CDD:238492
PDZ_signaling 587..671 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.