DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and grip2b

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_021325304.1 Gene:grip2b / 562290 ZFINID:ZDB-GENE-070705-172 Length:1086 Species:Danio rerio


Alignment Length:341 Identity:75/341 - (21%)
Similarity:115/341 - (33%) Gaps:111/341 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VTKTCHIVKRPDFDGYGF--------NLHSEK------VKPGQFIGKVDADSPAEAAG-LKEGDR 68
            ::||..|..:.:.:.:||        :.|..:      |:||         .||:..| ||.|||
Zfish   142 ISKTIEICLQKEGNSFGFVMRGGAHEDWHKSRPLVVTHVRPG---------GPADREGTLKSGDR 197

  Fly    69 ILEVNGVSIGSETHKQVVARIKAIANEVRLLLIDVDGKALE----------VKPASPPAAACNGN 123
            ||.|:||.:.|.||...:..:.....|. |..|:.|...::          |:.|..|.|:.   
Zfish   198 ILSVDGVVLHSATHSDALVVLTQCGQEA-LFQIEYDVSIMDSVTNASGPLLVEIAKAPGASL--- 258

  Fly   124 GSASQNGYEGTKQEM------PGA----------SANISSISMVSTKRSSNASSIQ-SGSTMNAS 171
            |..........||.:      ||:          ..:|.||...||:..|...:.| ..||.:.:
Zfish   259 GVTLTTALHRNKQAIVIDKIKPGSVVDRSGALHVGDHILSIDGTSTEHCSLLEATQLLASTSDQT 323

  Fly   172 DLDVVDR------GIPAVAAPVAITPPP-----------------------VQNGSKPSSPIN-- 205
            .|:::..      |.|.....|..:..|                       ....|.|||..:  
Zfish   324 KLEILPAHQTRLPGKPQDTVKVQKSDHPHCWDPCVNYCHSQHPGHCKTSTWTSASSNPSSSQDYC 388

  Fly   206 NNTLMSTPPPPSATKAGINNNGSVYNTNGNGTNGMTTPTTPPPPTSGYKAGTLHLPMTAAEMRAK 270
            .:.:.|...|.|.|.:|:.:.||           .|.|...|             ||:......|
Zfish   389 KSVVCSNFSPGSTTTSGMTSQGS-----------STLPRAAP-------------PMSPRNSMLK 429

  Fly   271 LASKKKYDPKNESVDL 286
            ...:|| :.|:.||.|
Zfish   430 RRQRKK-EHKSSSVSL 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 27/95 (28%)
grip2bXP_021325304.1 PDZ_signaling 45..127 CDD:238492
PDZ 144..232 CDD:214570 28/97 (29%)
PDZ_signaling 245..328 CDD:238492 19/85 (22%)
PDZ_signaling 462..548 CDD:238492
PDZ_signaling 561..643 CDD:238492
PDZ_signaling 659..740 CDD:238492
Peptidase_S41 672..>841 CDD:321971
PDZ_signaling 970..1050 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.