DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and pdzd3a

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_685398.3 Gene:pdzd3a / 557269 ZFINID:ZDB-GENE-080430-1 Length:520 Species:Danio rerio


Alignment Length:190 Identity:52/190 - (27%)
Similarity:82/190 - (43%) Gaps:31/190 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPTSPKTPTPPTLP--PGVTKTCHIVKRPDFDGYGFNLHSEKVKPGQ---FIGKVDADSPAEA 60
            |..|..|.......||  |   ||.|:.:.|  .||||.|..||::.|:   .:.::|..||||.
Zfish   263 MGLPIIPAFAETHNLPYRP---KTLHLTQGP--QGYGFLLRQEKLRSGRIAHILREIDPCSPAET 322

  Fly    61 AGLKEGDRILEVNGVSIGSETHKQVVARIKAIANEVRLLLIDVDGK----ALEVKP--------- 112
            ||:::|:.:|.|||..:....|:.:|::|:....:|.|..|.:.|:    .|.:.|         
Zfish   323 AGMEDGEIVLAVNGEQVEDAEHEGIVSKIRQSGQQVTLTTISIAGRDFYTQLAMSPLLFYDEHIP 387

  Fly   113 -----ASPPAAACNGNGSASQNGYEGTKQEMPGASANISSISMVSTKRSSNASSIQSGST 167
                 |:|......|:.:..|.......:|..|...|   :..|..|..:....:.||||
Zfish   388 KCEPFATPALEHPEGHQNPPQPRLCELHKEGTGFGFN---LGCVENKPGTYIGQVVSGST 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 29/83 (35%)
pdzd3aXP_685398.3 PDZ_signaling 61..142 CDD:238492
PDZ_signaling 172..252 CDD:238492
PDZ 280..363 CDD:214570 30/87 (34%)
PDZ 408..490 CDD:214570 10/40 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D377274at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26228
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.