DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and lnx2a

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001106696.2 Gene:lnx2a / 553331 ZFINID:ZDB-GENE-060228-2 Length:737 Species:Danio rerio


Alignment Length:323 Identity:65/323 - (20%)
Similarity:106/323 - (32%) Gaps:101/323 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PTLPPGVTKTCHIVKRPDFDGYGFNLHSEKVKP--GQFIGKVDADSPAEAAG-LKEGDRILEVNG 74
            |:||.|...|..:.:...:...|.::......|  ...|.:|..|......| |..||:||:||.
Zfish   261 PSLPEGEITTIEVHRTNPYSEMGISIVGGNETPLINVVIQEVYRDGVIARDGRLLAGDQILQVNN 325

  Fly    75 VSIGSETH---KQVVARIKA-----IANEVRLLLIDVDGKALEVKPASPPAAACNGNGSASQNGY 131
            |.|.:..|   :..:||..|     :..|.|.             .|.||||..:..||.:....
Zfish   326 VDISNVPHNFARSTLARPCATLQLTVLRERRC-------------SARPPAATASPKGSPASIRI 377

  Fly   132 EGTKQEMPGASANISSISMVSTKRSSNA-----SSIQSGSTMNASDLDVVDR-----------GI 180
            ...|:|    |:....|.:|  :|:..|     ..::.|.......|...||           |.
Zfish   378 TLHKRE----SSEQLGIKLV--RRTDEAGVFILDLLEGGLAAKDGRLCSNDRVLAVNEHDLRHGT 436

  Fly   181 PAVAAPVAITPPP-----VQNGSKPSSPINNNTLMS--------TPPPPSATKAGINNNGSVYNT 232
            |.:||.:......     :...||.:..::..:.::        .||.||               
Zfish   437 PELAAQIIQASGERVNLLISRSSKQTMAVHTGSTLTRDIWSHDHIPPLPS--------------- 486

  Fly   233 NGNGTNGMTTPTTPPPPTSGYKAGTLHLPMTAAEMRAKLASKKKYDPKNESVDLKKKFDIIQK 295
                     |.|..|.|       :|||..::.:.           ..::.|:.|:|...::|
Zfish   487 ---------TATPSPVP-------SLHLARSSTQR-----------DLSQCVNCKEKHITVKK 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 22/91 (24%)
lnx2aNP_001106696.2 zf-RING_2 49..87 CDD:290367
PDZ 267..353 CDD:214570 20/85 (24%)
PDZ_signaling 375..455 CDD:238492 15/85 (18%)
PDZ_signaling 515..600 CDD:238492 2/8 (25%)
PDZ_signaling 646..730 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.