DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Pdzd3

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001178925.1 Gene:Pdzd3 / 500986 RGDID:1559807 Length:498 Species:Rattus norvegicus


Alignment Length:221 Identity:58/221 - (26%)
Similarity:95/221 - (42%) Gaps:52/221 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PGVTKTCHIVKRPDFDGYGFNLHSEK---VKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIG 78
            |...:..:|.|.|  .|:||.|..||   .:.|||:.:||...||:.||:|.|||::.|.|.|:.
  Rat   258 PAKPRCLNIEKGP--QGFGFLLREEKGPDGRLGQFLWEVDPGLPADKAGMKAGDRLVAVAGESMD 320

  Fly    79 SETHKQVVARIKAIANEVRLLLIDVDG----KALEVKP---------ASPPAAACNG---NGSAS 127
            ...|::.|:||:|..:.|.|:::|.:.    ..:.:.|         |:.|.|....   ..:..
  Rat   321 GLGHEETVSRIRAQGSCVSLVVVDPEADRFFSMVRLSPLLFLENTEIAAAPLAETKDLPVEDTVE 385

  Fly   128 QNGYEGTKQ----EMPG----------ASANISSISMVSTKRSSNASSIQSGSTM---------N 169
            .:|..|::|    ..||          ||.....||.|:...|:..:.:|.|..:         .
  Rat   386 PSGLAGSRQCFLYPGPGGGYGFRLRCVASGPCLFISQVTPGGSAARAGLQMGDAILEVNGCPVGG 450

  Fly   170 ASDLDVVDRGIPAVAAPVAITPPPVQ 195
            .||||.:.:        :|...||::
  Rat   451 DSDLDTLQQ--------LAEAEPPLR 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 32/83 (39%)
Pdzd3NP_001178925.1 PDZ_signaling 47..127 CDD:238492
PDZ_signaling 155..232 CDD:238492
PDZ 260..345 CDD:214570 32/86 (37%)
PDZ_signaling 407..472 CDD:238492 15/70 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D377274at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44813
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.