DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and CG6688

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster


Alignment Length:395 Identity:77/395 - (19%)
Similarity:120/395 - (30%) Gaps:154/395 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PDFDGYGFNLHSEKVKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIKAIA 93
            |..:.|||.|...|..|..::.:|.|.:||...|||.||.:|||||..:......::...:|:..
  Fly    34 PAMENYGFQLTRSKWDPYPWVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIAKMVKSQK 98

  Fly    94 NEVRLLL------IDVDGKALEVKP---------------------------ASPPAAAC-NGN- 123
            :.|.:|.      .|.|..::...|                           .||||..| ||: 
  Fly    99 DCVTILCWNSECDKDCDTNSICCAPMPTSLRRLSLVLESILRLVECPVCGVTISPPAMQCQNGHL 163

  Fly   124 --------------------------------------------GSASQNGYEGTKQEMPGASAN 144
                                                        ....|..:.|..:.:.|....
  Fly   164 LCVDCRIRSERCPVCRDFYTPRRALLAEQIFLTIANAFEMCRSENKLRQKLFAGITRPVVGRQDR 228

  Fly   145 ISSISMVSTKR-------------------SSNASSIQSGSTMNASDLDVV--DRGIPAVAAPVA 188
            |:.......:|                   :.|.|...:.:.:..:..||.  ...|||..:||.
  Fly   229 ITGQDTWRKRRPVLPTNKFLTKLLEGCAYSTDNLSPSNAATLLRTNTTDVAGDSSEIPARTSPVT 293

  Fly   189 ITPPP----------------------VQNGSKPS-------SPINNNTLMST----PPPPSATK 220
            .|||.                      .|.|.||:       |..|::.:.:|    ||.|::..
  Fly   294 ATPPERTTMHATLDANAAHPSLSTNDLQQEGVKPNAEGVDEESGTNSSHISATSLHGPPLPASVS 358

  Fly   221 AGINNNGSVYNTNGNGTNGMTTPTTPPPPTSGYKAGTLHLPMTAAEMR-AKLASK---KKYDPKN 281
            .|||.:..:            .|...||.|.     :..||....:.: |.|..:   |..||::
  Fly   359 PGINESSGL------------QPVRIPPVTP-----SQDLPQQVVQTKPASLLYRCPCKLQDPQD 406

  Fly   282 ESVDL 286
            .:.||
  Fly   407 PAKDL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 24/77 (31%)
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.