DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and CG34375

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster


Alignment Length:104 Identity:26/104 - (25%)
Similarity:46/104 - (44%) Gaps:19/104 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GFNLHSEKVKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIKAIANEVR-- 97
            |.||......|..::..|.|.|.||..|::.||.:||:||..:       :..:|..:||.::  
  Fly    16 GLNLSRAPWDPYPWVSGVQAKSSAERGGVRLGDTLLELNGADV-------LGLKISELANRLQDH 73

  Fly    98 ------LLLIDVDGKALEVKPASPPAAACNGNGSASQNG 130
                  ::.:.:..:...:.|...||.|.:    |.|:|
  Fly    74 WQSGAEVVTLMMWRQQANIDPNEDPAEASH----AVQHG 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 19/73 (26%)
CG34375NP_001163693.1 PDZ 13..86 CDD:238080 19/76 (25%)
RING 129..168 CDD:238093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.