DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Mhcl

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_732109.2 Gene:Mhcl / 41955 FlyBaseID:FBgn0026059 Length:2194 Species:Drosophila melanogaster


Alignment Length:242 Identity:54/242 - (22%)
Similarity:86/242 - (35%) Gaps:72/242 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PTPPT----LPPGVTKTCHIVKRPDFDGYGFNL-------HSEKVKPGQFIGKVDADSPA--EAA 61
            |.||.    |||.........|.|..| :||:|       .:|.:....|...:.|:..|  .|.
  Fly   323 PLPPVQLVKLPPPRQLVIRRQKSPRQD-FGFSLRKAICLDRTESLTSPIFRPVIFAEPGAGGGAT 386

  Fly    62 GLKEGDRILEVNGVSIGSETHKQVVARIKAIANEVRLLLIDVDGKA----LEVKPASPPAAA--- 119
            ||..|||:::|||..:| |..::::  |:.|.|....:.::|...|    |..:..:|..|.   
  Fly   387 GLLPGDRLIKVNGTPVG-ELPREII--IEMIRNSGEAVTVEVQPVAELVELSKRCMAPSTATVEE 448

  Fly   120 ---------C------------------NGNGSASQNGYEGTKQEMPGASANISSISMV------ 151
                     |                  ||||...:.|.:|...::....|:.|....|      
  Fly   449 IDHSITNGNCNTLRRSASKRFKRQSRHENGNGGGEEGGAKGVGHDLEADVADASQPERVWLVHRG 513

  Fly   152 ---STKRSSNASS------------IQSGSTMNASDLDVVDRGIPAV 183
               :..|...|||            :.:|..:...:.||..:..||:
  Fly   514 GFTAAIRLPTASSGRDEENKLSLRLLHNGEQLTVDEDDVEKQNSPAL 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 24/89 (27%)
MhclNP_732109.2 PDZ_signaling 339..426 CDD:238492 24/90 (27%)
MYSc 556..1317 CDD:214580 2/5 (40%)
MYSc_Myo18 575..1305 CDD:276837
GBP_C <1540..1750 CDD:303769
COG1340 1565..1833 CDD:224259
coiled coil 1723..1734 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.