DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Syn1

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster


Alignment Length:273 Identity:52/273 - (19%)
Similarity:81/273 - (29%) Gaps:127/273 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 HI-VKRPDFDGYGFNLHSEKVKPGQ------FIGKVDADSPA-EAAGLKEGDRILEVNGVSIGSE 80
            |: :.:.|.:|.|.:     :|.|:      .|.|:.....| :|.||..||.||.|||..:...
  Fly   164 HVRIIKSDNNGLGIS-----IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDA 223

  Fly    81 THKQVVARIKAIANEVRLLLIDVDGKAL-EVKPASPPAAACNGNGSASQNGYEGTKQEMPGASAN 144
            ||.:.|..:|....     ::|::.|.| ||.|....|:.      .|:.|:|..:         
  Fly   224 THDEAVRALKRSGR-----VVDLEVKFLREVTPYFRKASI------ISEVGWELQR--------- 268

  Fly   145 ISSISMVSTKRSSNASSIQSGSTMNASDLDVVDRGIPAVAAPVAITPPPVQNGSKPSSPINNNTL 209
                                                 |...|:                      
  Fly   269 -------------------------------------AFLCPL---------------------- 274

  Fly   210 MSTPPPPSATKAGINNNGSVYNTNGNGTNGMTTPTTPPPPTSGYKAGTLHLPMTAAEMRAKLASK 274
                                         |...||:||.|.:..:|.|.::|:....    ||..
  Fly   275 -----------------------------GPGVPTSPPAPKTTPRADTRYIPLQLTH----LARN 306

  Fly   275 KKY-DPKNESVDL 286
            .|| ||:|...:|
  Fly   307 LKYIDPENRCFEL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 23/84 (27%)
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622
PDZ_signaling 163..244 CDD:238492 24/89 (27%)
PHsplit_syntrophin <293..351 CDD:269960 10/31 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.