DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Zasp66

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster


Alignment Length:344 Identity:75/344 - (21%)
Similarity:115/344 - (33%) Gaps:88/344 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTSPK---TPTPPTLPPGVTKTCHIVKRPDFDGYGFNLHSEKVKPGQFIGKVDADSPAEAAGLKE 65
            |||.:   ||.||.:|  :...|   :|....|....:|   ....|.:| |...|||... |..
  Fly    26 PTSYRPQPTPKPPLVP--LPSPC---RRRSSSGLKKRVH---FADEQNVG-VQVGSPAHGE-LLR 80

  Fly    66 GDRILEVNGVSIGSETHKQVVARIKAIANEVRLLLIDVDGKALEVKPASPPAAACNGNGSASQN- 129
            ||.|.::........:|.......:...||:| |::..|.|....:.|:..|    |.||.|.: 
  Fly    81 GDIISKIGEYDARDLSHADAQQLFRGAGNEIR-LVVHRDNKIAYTQGATQEA----GPGSRSNST 140

  Fly   130 ---------GYEGTKQEMPGAS-------ANISSISMVSTKRSSNASSIQSGSTM--------NA 170
                     .:.|....:||.|       ..:.::......:.:::...:..||:        :.
  Fly   141 LPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDHQ 205

  Fly   171 SDLDVVDRGIPAVAAPVAITPPPVQNGS-KPSSPINNNTLMSTPPPPSATKAGIN---------- 224
            .|:|.....|  |..|...||..:.... |..:|...:.|...|.|......|.:          
  Fly   206 QDVDEEQAAI--VNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRV 268

  Fly   225 -------------NNGSVYNTNGNGTNGM--------TTPTTPPPPTS---GYKAGTLHLPMTAA 265
                         :.|.|::...|...|:        |..:|.|..||   ..|...||.|:.  
  Fly   269 ADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLP-- 331

  Fly   266 EMRAKLASKKK---YDPKN 281
               .||...||   |||:|
  Fly   332 ---TKLNGYKKTVQYDPRN 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 19/80 (24%)
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 13/48 (27%)
DUF4749 285..359 CDD:292558 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.