DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Fife

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001261340.1 Gene:Fife / 38337 FlyBaseID:FBgn0264606 Length:1314 Species:Drosophila melanogaster


Alignment Length:249 Identity:52/249 - (20%)
Similarity:87/249 - (34%) Gaps:80/249 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IVKRPDFD------GYGFNLHSEKVKPGQFIGKVDAD-------------SPAEAAGLKEGDRIL 70
            |::|...|      |:|..:..         ||..||             ..||..||::||:||
  Fly   494 ILRRDPTDKAHRTRGFGMRVVG---------GKTGADGRLFAYIVWTVPGGAAEKNGLQQGDKIL 549

  Fly    71 EVNGVSIGSETHKQVVARIKAIANEVRLLLID-VDGKALEVKPASPPAAACNGNGSASQNGYEG- 133
            |.||:|:...:.::|.:.:....:.|.||:.. .|.:..::...:.|.....|.....::| :| 
  Fly   550 EWNGMSLIDRSFEEVCSIMDRTGDVVELLVEHATDFRMCDLFDENLPPGNAGGQSGPRRSG-DGP 613

  Fly   134 --------------------TKQEMPGASANISSISMVS----------TKRSSNASSIQSGSTM 168
                                |::::|.....|:...:|:          .:||....|:.:|..:
  Fly   614 VGLGLIAEPETTTDKSPASPTRRKLPKTPEQIAREKLVTGRVQIQVWYHAERSELVVSLMAGDDL 678

  Fly   169 NASDLDVVDRGIPAVAAPVAITPP-------------PVQNGSKPSSPINNNTL 209
            ...|.......:|...|.|.|.|.             |.||      ||.|.||
  Fly   679 APRDEAYGHGNLPEAYAKVRILPKCGDGSVQQTEVSRPTQN------PIWNATL 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 25/94 (27%)
FifeNP_001261340.1 FYVE_BSN_PCLO 130..187 CDD:277290
PDZ_signaling 491..580 CDD:238492 25/94 (27%)
DegQ <526..577 CDD:223343 14/50 (28%)
C2A_RIM1alpha 651..779 CDD:175997 19/82 (23%)
C2 1163..1304 CDD:301316
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.