DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and inaD

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster


Alignment Length:147 Identity:45/147 - (30%)
Similarity:60/147 - (40%) Gaps:19/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GQFIGKVDADSPAEAAG-LKEGDRILEVNGVSIGSETHKQVVARIKAIANEVRLLLIDVDGKALE 109
            |.||..:..||||...| ||.|||||.:||..:.:.|.:.|:..||....::.|.:...| |:.|
  Fly    59 GIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQTFD-KSDE 122

  Fly   110 VKPASPPAA--------------ACNGNGSASQNGYEGTKQEMPGASANISSISMVSTKRSSNAS 160
            .:..|.|.:              ..|.|.|..|...:|..|....|..|... ||.....:..||
  Fly   123 QQAKSDPRSNGYMQAKNKFNQEQTTNNNASGGQGMGQGQGQGQGMAGMNRQQ-SMQKRNTTFTAS 186

  Fly   161 SIQSGSTMNASDLDVVD 177
            ..|..|  |.:|.|..|
  Fly   187 MRQKHS--NYADEDDED 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 22/55 (40%)
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492 22/55 (40%)
PDZ_signaling 259..340 CDD:238492
PDZ_signaling 377..457 CDD:238492
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.