DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Dlg5

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_609505.1 Gene:Dlg5 / 34573 FlyBaseID:FBgn0032363 Length:1916 Species:Drosophila melanogaster


Alignment Length:234 Identity:56/234 - (23%)
Similarity:95/234 - (40%) Gaps:51/234 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LPPGVTKTCHIVKRPDFDGYGFNLHSEKVKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIGS 79
            |.||..:...|.||.  ...|..:.......|.|:..|...|.|..|||:.||::|||.|:::.:
  Fly  1285 LCPGDLRRVTIDKRD--KSLGITIQCNNNGGGIFVSTVADKSTAMRAGLQVGDQLLEVCGINMRA 1347

  Fly    80 ETHKQVVARIKAIANEVRLLL---------IDVDGKALEVKPASPPAAACNGNGSAS-------- 127
            .|.:.....::...:...:|:         |:.:| |..::|.||    .|.:||.:        
  Fly  1348 ATQEIAANVLRQCGDSFTMLVQYNPEKFPSIEYEG-AHNLEPESP----INHSGSPTPRNSPRPP 1407

  Fly   128 ----------QNGYEGTKQEMPGASANISSISMVSTKRSSNASSIQSGSTMNASDLDVVDRGIPA 182
                      |.....|:   ||:.|.:|..|:   |..|...|:::.|.:::|      :.:|:
  Fly  1408 ARNSLFPLPMQPQAPSTR---PGSRAPLSHQSI---KDQSFTDSLENQSDISSS------QDMPS 1460

  Fly   183 VAAPVAITPPPVQNGSKPSSPINNNTLMSTPPPPSATKA 221
            .||....|     ..|..|:..:.....|.||||::..|
  Fly  1461 SAATTTTT-----TASATSTVYDEEPKPSLPPPPASVPA 1494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 20/89 (22%)
Dlg5NP_609505.1 AAA_23 <165..333 CDD:290211
CENP-F_leu_zip 229..360 CDD:287450
DUF1090 <326..408 CDD:284007
PDZ_signaling 439..516 CDD:238492
PDZ_signaling 533..592 CDD:238492
PDZ_signaling 1290..1369 CDD:238492 20/80 (25%)
PDZ_signaling 1497..1576 CDD:238492
SH3_DLG5 1594..1657 CDD:212794
Guanylate_kin 1737..1904 CDD:279019
NK <1773..1905 CDD:302627
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.