DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and pdzk1

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001122142.2 Gene:pdzk1 / 337325 ZFINID:ZDB-GENE-031222-1 Length:553 Species:Danio rerio


Alignment Length:241 Identity:63/241 - (26%)
Similarity:97/241 - (40%) Gaps:68/241 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LPPGVTKTC--HIVKRPDF-------DGYGFNLHSEKVKPGQFIGKVDADSPAEAAGLKEGDRIL 70
            :.|||:...  |:..:|..       |||||.|..:..:.|..||::|..||||.||:|:.||:.
Zfish   217 IQPGVSHATVKHLPHKPRIADMIKRADGYGFMLKEDPKRKGHCIGEIDKGSPAERAGMKDMDRLA 281

  Fly    71 EVNGVSIGSETHKQVVARIKAIANEVRLLLIDVD-GKALEVKPASPPAAACNGNGSASQNGYEGT 134
            .|||..|.:..|:|||.:| ...|:..||::|.: .|..::...||...            :|..
Zfish   282 AVNGEDIENCKHEQVVEKI-CQGNKCCLLVLDAETDKIYKLGGVSPLLY------------WEEM 333

  Fly   135 KQEMPGASANISSISMVSTKRSSNASSIQSGSTMNASDLDVVDRGIPAVAAPVAITPPPVQNGSK 199
            :..:||...|                        .|..:..|...:|  ||.||.||.|....:.
Zfish   334 RGSLPGYPDN------------------------EAVAIPAVAAAVP--AAVVAATPAPAATPAP 372

  Fly   200 PSSPINNNTLMSTPPPPSATKAGINNN-----------GSVYNTNG 234
            .::|        ||.|.:|..|.:::.           |..::.||
Zfish   373 AATP--------TPVPAAAEPADVDHKPKLCRLERTSAGFGFHLNG 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 33/89 (37%)
pdzk1NP_001122142.2 PDZ_signaling 6..86 CDD:238492
PDZ_signaling 126..204 CDD:238492
PDZ 232..311 CDD:214570 32/79 (41%)
PDZ_signaling 392..471 CDD:238492 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D377274at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26228
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.