DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and CG43707

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001260005.1 Gene:CG43707 / 33601 FlyBaseID:FBgn0263846 Length:2021 Species:Drosophila melanogaster


Alignment Length:101 Identity:30/101 - (29%)
Similarity:53/101 - (52%) Gaps:7/101 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GVTKTCHIVKRPDFDGYGFNLHSEKVKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIGSETH 82
            ||.||  :|.:.|...:||.:|..|   ...:..::.::|||::||:.||.|:.||||.:..:.|
  Fly  1697 GVDKT--VVVKSDSGEFGFRIHGSK---PVVVAAIEPETPAESSGLEVGDIIISVNGVQVLDKHH 1756

  Fly    83 KQVVARIKAIANEVRLLLIDVDGKAL--EVKPASPP 116
            .:||........::.|.:....|..:  :::|.|.|
  Fly  1757 TEVVKIAHDGCEKLELQVARTIGVLMHEQLEPPSQP 1792

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 24/80 (30%)
CG43707NP_001260005.1 PHA03369 <987..1394 CDD:223061
PDZ_signaling 1702..1775 CDD:238492 22/75 (29%)
PH 1792..1894 CDD:278594 1/1 (100%)
PH-like 1792..1893 CDD:302622 1/1 (100%)
PH-like 1911..2011 CDD:302622
PH 1921..2014 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.