DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and synj2bp

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_956211.1 Gene:synj2bp / 334599 ZFINID:ZDB-GENE-030131-6531 Length:152 Species:Danio rerio


Alignment Length:133 Identity:29/133 - (21%)
Similarity:56/133 - (42%) Gaps:22/133 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GYGFNL------HSEKVKPGQFIGKVDADSPAEAAG-LKEGDRILEVNGVSIGSETHKQVVARIK 90
            |.|||:      .......|.::.|:..:..|...| |:|||:||.:||..:.:.:|...|...:
Zfish    22 GLGFNIVGGVDQQYMMNDSGIYVAKIKENGAAALDGRLQEGDKILAINGRKLDNLSHGAAVELFR 86

  Fly    91 AIANEVRLLLIDVDGKALEVKPA---SPPAAACNGNGSASQNGYEGTKQEMPGASANISSISMVS 152
            :...:|.|        .::.:|.   .|.::..:|..|::.    ||.......:..:.:.|.::
Zfish    87 SAGEDVHL--------CIQQRPVLQNGPTSSRADGESSSAL----GTWTLFAVVTLAVMTASFIA 139

  Fly   153 TKR 155
            .||
Zfish   140 YKR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 20/74 (27%)
synj2bpNP_956211.1 PDZ_signaling 17..97 CDD:238492 20/82 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.