DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and gopc

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_956851.1 Gene:gopc / 326887 ZFINID:ZDB-GENE-030131-5086 Length:455 Species:Danio rerio


Alignment Length:214 Identity:47/214 - (21%)
Similarity:74/214 - (34%) Gaps:73/214 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PKTPTPPTLPPG--------------VTKTCHIVKRPDFDGYGFNL-----HSEKVKPGQFIGKV 52
            ||.|.|.  |.|              :.|.  ::.:.|.:|.|.::     |...:    .|.::
Zfish   261 PKKPLPS--PVGHDTDSLKKTQGVGPIRKV--VLTKEDHEGLGISITGGKEHGVPI----LISEI 317

  Fly    53 DADSPAE-AAGLKEGDRILEVNGVSIGSETHKQVVARIKAIANEVRLLL------IDVDGKALEV 110
            ....||| ..||..||.||.||.:::....||:.|..:.....|:...:      :|.|.:.:|.
Zfish   318 HPTQPAERCGGLHVGDAILAVNNINLRDAKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEY 382

  Fly   111 KPAS------------PPAAACNGNGSA----------------SQNGYEGTKQEMPGASANISS 147
            :..|            ..:||.:.||:|                ::||..|...|.|.       
Zfish   383 EDDSGHRYRLYLDELEEASAANHNNGTADPASLQAVGKHLVNNRTENGDVGLSSECPS------- 440

  Fly   148 ISMVSTKRSSNASSIQSGS 166
                ..|.|..|.|.:|.|
Zfish   441 ----DDKTSKTAESAESSS 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 21/92 (23%)
gopcNP_956851.1 PDZ_signaling 285..367 CDD:238492 21/87 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.