DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and CG5921

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_727061.2 Gene:CG5921 / 31538 FlyBaseID:FBgn0029835 Length:886 Species:Drosophila melanogaster


Alignment Length:321 Identity:68/321 - (21%)
Similarity:116/321 - (36%) Gaps:91/321 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IVKRPDFDGYGFNLHSEKVKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIGSETHKQVVARI 89
            |.|.|::            |||.|:......|.|..|||:.||:||.||.:........:.||.:
  Fly   213 ICKGPEW------------KPGIFVQFTKDRSVAREAGLRPGDQILSVNSIDFSDVLFSEAVAVM 265

  Fly    90 KAIANEVRLLLIDVDGKALEVKPASPPAAACN---GNGSASQNGYEGTKQEMPGAS----ANISS 147
            |:.:.      :|:..:.         ||.|:   |..|    ||..:...:.|..    |:..|
  Fly   266 KSSSK------LDMVVRT---------AAGCDLFPGESS----GYNSSASSVTGDQSPCWADAKS 311

  Fly   148 ISMVSTKRSSNA--------SSIQSGS-----------TMNASDLDVVDRGIPAVAAPVAITPPP 193
            ..:.:.:..|.|        |:..:||           .||.:.:.:.:.|.......:|.|...
  Fly   312 KRLTAVREESGAGGGGCGLSSAPGAGSPNWSQGVEVHKQMNKTIIKLTENGTSINNTYIASTGGS 376

  Fly   194 VQNG----------------SKPSSPINNNTLM--STPPPPSATKAGIN-NNGSVYNT------- 232
            ..:|                |.||:|..|:|.|  |...|.::..:||. ::||..:.       
  Fly   377 SVSGSGSTGSGTSGRSQQSQSNPSNPSRNSTTMKRSHLRPVNSAGSGIGLSSGSAGSAGSAGSSG 441

  Fly   233 NGNGTNGMTTPTTPPPP--------TSGYKAGTLHLPMTAAEMRAKLASKKKYDPKNESVD 285
            :|:.:.|:..|...|||        .||....:|...:|....:.|...:::...:..:.|
  Fly   442 SGSRSGGVIAPAPAPPPPAMNEGANASGSVGSSLSSAITEELKKRKEKQQQQQHQQRHNRD 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 21/75 (28%)
CG5921NP_727061.2 PDZ_signaling 82..152 CDD:238492
PDZ_signaling 197..276 CDD:238492 22/80 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.