DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Whrn

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_038965801.1 Gene:Whrn / 313255 RGDID:631330 Length:969 Species:Rattus norvegicus


Alignment Length:479 Identity:89/479 - (18%)
Similarity:120/479 - (25%) Gaps:243/479 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTSPKTPTPPTLPPGVT---------KTCHIVKRPD--------FDG------------YGFNLH 39
            |....|..|.:||.|.|         ...|:::..|        .||            ||..::
  Rat   240 PQGRSTSPPSSLPHGSTLRQHEDDRRSALHLLQSGDEKKVNLVLGDGRSLGLTIRGGAEYGLGIY 304

  Fly    40 SEKVKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIK-------------- 90
            ...|.||         |.||::|||.||:||||||.|..|..|.:.|..:|              
  Rat   305 ITGVDPG---------SEAESSGLKVGDQILEVNGRSFLSILHDEAVKLLKSSRHLILTVKDVGR 360

  Fly    91 -------------------------------------------------------AIANEVRLLL 100
                                                                   ::.|:.|.||
  Rat   361 LPHARTTVDQTKWIASSRIGESITNSAGFPGDLTEEGTNKPGFYKGPAGSQVTLSSLGNQTRALL 425

  Fly   101 ID-------------------------VDGKAL-------------------------------- 108
            .|                         :..:||                                
  Rat   426 DDQARHLLTEQERATMMYYLDQYRGGTISVEALVMALFELLNTHAKFSLLSEVRGIISPQDLDRF 490

  Fly   109 ----------EVKPASPPAAACNGNGSASQNGYEGTKQEMPGASANISSIS---------MVSTK 154
                      .:|...||........|.......|:.....|.|..:||..         |.:|.
  Rat   491 DHLVLRREIESMKARQPPGPGVGDTYSMVSYSDTGSSTGSHGTSTTVSSARERLLWLIDLMENTL 555

  Fly   155 RSSNASSIQSGSTMNASDLDVVDRGIPAVAAPVAITPP-------------------PVQNGSKP 200
            ..........|||....|:.|.|...|:...| .|.||                   ||:..|.|
  Rat   556 DLEGTGETTQGSTNALPDVSVDDVRSPSEDLP-GIKPPPPPPPLAQGHDRLLGQTRKPVREDSAP 619

  Fly   201 -----------SSPINNNTLMSTPPPPSATKAGINNNGSVYNTNGNGTNGMTTPTTPPPPTSGYK 254
                       |:|.|.    |.||||     ||                  .||..|.|:|...
  Rat   620 LSSAAHSGIVFSAPRNR----SPPPPP-----GI------------------APTPTPGPSSARD 657

  Fly   255 AGTLHLPMTAAEMRAKLASKKKYD 278
            :.:  .|:.|:...|..:|:|..|
  Rat   658 SPS--SPIYASISHANPSSRKPLD 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 32/178 (18%)
WhrnXP_038965801.1 HN_L-whirlin_R1_like 38..113 CDD:259822
PDZ_signaling 139..216 CDD:238492
PDZ_signaling 276..356 CDD:238492 26/88 (30%)
HN_L-whirlin_R2_like 418..498 CDD:259823 7/79 (9%)
PDZ_signaling <908..949 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.