DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and PsGEF

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_996333.4 Gene:PsGEF / 31224 FlyBaseID:FBgn0264598 Length:2777 Species:Drosophila melanogaster


Alignment Length:349 Identity:75/349 - (21%)
Similarity:122/349 - (34%) Gaps:84/349 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STPTSPKTPTPP---TLPP----GV-TKTCHIVKRPDFDGYGFNLHSEKVKPGQFIGKVDA---- 54
            |||.|....:|.   ||.|    |: |.:...:|.|..|........::.:.....|.|.:    
  Fly  1177 STPLSSPLDSPDVLNTLVPLSDIGLTTASMGSMKLPSLDSIHLKQQQKQQRTNNSHGHVHSATGV 1241

  Fly    55 --DSPAEAA-----GLKEGD------------RILEVNGVSIGSETH-----------KQVVARI 89
              |..|:.:     |:..|.            |||...|....|..|           :|..||:
  Fly  1242 ATDRTADRSHGHNHGIHGGHVEQIELLIDEKCRILNKTGTPKSSALHLANWMKGQLDKQQQQARL 1306

  Fly    90 KAIAN-------EVRLLLIDVDG-----------KALEVKPASPPAAACNGNGSASQN----GYE 132
            .|||.       |...|:.:.|.           :.||.:......|..||..||..|    ...
  Fly  1307 AAIARSQENVSAEDEQLIFNSDSEQDERITYWTRQQLEKRTKELNLAKENGGLSARPNFGGKRLS 1371

  Fly   133 GTKQEMPGASANISSISMVSTKRSSNASSIQSGSTMNASDLDVVDRGIPAVAAPVAITPPPVQN- 196
            |.::....|:::|     .||..:...:|:.|.|....||..:..|..|.|...:|:.....:| 
  Fly  1372 GVEELSMSATSDI-----YSTSEAEGVTSVISQSHSTTSDSQITVRSSPIVLDKLAVCRHCHKNC 1431

  Fly   197 ------GSKP--SSPINNNTLMSTPPPPSATKAGINNNGSVYNTNGNGTNGMTTPTTPPPPTSGY 253
                  |::|  ...:||:   |:.|........:.::.|..|.....:||:...|....|.:..
  Fly  1432 QQSGPGGARPGGGGGVNNS---SSTPVLLCNSLKVQHSQSSPNRCCKLSNGIAGATEMANPKNSN 1493

  Fly   254 KAGT---LHLPMTAAEMRAKLASK 274
            :.||   ....|:::.:..:|:||
  Fly  1494 RTGTGTGSVTSMSSSTITGELSSK 1517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 24/121 (20%)
PsGEFNP_996333.4 DUF4799 <102..209 CDD:292674
C2 286..>381 CDD:278593
PDZ_signaling 644..716 CDD:238492
RhoGEF 831..1000 CDD:295373
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.