DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Cytip

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001012086.1 Gene:Cytip / 311047 RGDID:1307990 Length:359 Species:Rattus norvegicus


Alignment Length:136 Identity:42/136 - (30%)
Similarity:56/136 - (41%) Gaps:39/136 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TPTSPKT-----------PTPPTLPPGVTK------------TCH-----IVKRPDFDGYGFNLH 39
            |.|.|.|           .|..|||.|..:            :|.     .|::.|...:||.:.
  Rat    29 TLTGPLTVEDNRRIQMLADTVATLPRGRKQLALARSSSLGDFSCSQRKVVTVEKQDNGTFGFEIQ 93

  Fly    40 SEKVKPGQ--------FIGKVDADSPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIKAIANEV 96
            :.:::...        .|.||..||||..|||:.||....|||||....||||||..|::..|  
  Rat    94 TYRLQNQNICSSEVCTMICKVQEDSPAHCAGLQVGDIFANVNGVSTEGFTHKQVVDLIRSSGN-- 156

  Fly    97 RLLLID 102
             ||.|:
  Rat   157 -LLTIE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 32/105 (30%)
CytipNP_001012086.1 PDZ_signaling 76..161 CDD:238492 31/87 (36%)
Interaction with CYTH1. /evidence=ECO:0000250 166..188
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.