DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Gopc

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001101101.2 Gene:Gopc / 309774 RGDID:1309512 Length:463 Species:Rattus norvegicus


Alignment Length:189 Identity:39/189 - (20%)
Similarity:62/189 - (32%) Gaps:72/189 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PPTLPPG--------------VTKTCHIVKRPDFDGYGFNLHSEK----------VKPGQFIGKV 52
            |...|||              :.|.  ::.:.|.:|.|.::...|          :.|||     
  Rat   266 PMQAPPGHDQDSLKKSQGVGPIRKV--LLLKEDHEGLGISITGGKEHGVPILISEIHPGQ----- 323

  Fly    53 DADSPAE-AAGLKEGDRILEVNGVSIGSETHKQVVARIKAIANEVRLLL------IDVDGKALEV 110
                ||: ..||..||.:|.||||::....||:.|..:.....|:...:      :|.|.:.:|.
  Rat   324 ----PADRCGGLHVGDAVLAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEY 384

  Fly   111 KPAS---------------PPAAACNGNG---------------SASQNGYEGTKQEMP 139
            :..|               ...|:|..:.               .|.:||..|...|.|
  Rat   385 EDESGHRYRLYLDELEGGGNSGASCKDSSGEMKVLQGYNKKTVRDAHENGDVGASGESP 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 23/97 (24%)
GopcNP_001101101.2 SMC_prok_B <35..>215 CDD:274008
PDZ_signaling 287..369 CDD:238492 23/92 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.