DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Ush1c

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_006229284.1 Gene:Ush1c / 308596 RGDID:1303329 Length:910 Species:Rattus norvegicus


Alignment Length:193 Identity:47/193 - (24%)
Similarity:76/193 - (39%) Gaps:44/193 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GQFIGKVDADSPAEAAGLKEGDRILEVNGVSIGSETHKQVVARI---KAIANEVRLL-LIDVDGK 106
            |.||..:.....|::.||:.||.|:.:||.||.|.||::|:..|   |.::.:||.: ||.|...
  Rat   111 GLFISHLIKGGQADSVGLQVGDEIVRINGYSISSCTHEEVINLIRTKKTVSIKVRHIGLIPVKSS 175

  Fly   107 ALEVKPASPPAAACNGNGSASQNGYEGTKQEMPGASANISSISMVSTKRSSNASSIQSGSTMNAS 171
            ..|      |......:...|::|         |....:||....:||......|:         
  Rat   176 PEE------PLKWQYVDQFVSESG---------GVRGGLSSPGNRTTKEKKVFISL--------- 216

  Fly   172 DLDVVDRGIPAVAAPVAITPPPVQNGSKPSSPINNNTLMSTPPPPSATKAGINNNGSVYNTNG 234
               |..||:..     :|:..|:|   ||...::|     ..|...:.:.|:.....:...||
  Rat   217 ---VGSRGLGC-----SISSGPIQ---KPGIFVSN-----VKPGSLSAEVGLETGDQIVEVNG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 21/58 (36%)
Ush1cXP_006229284.1 harmonin_N 2..80 CDD:259819
PDZ_signaling 85..165 CDD:238492 19/53 (36%)
PDZ_signaling 209..289 CDD:238492 14/80 (18%)
Cgr1 <316..>358 CDD:281823
PDZ_signaling 751..838 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.