DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and WHRN

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_011516787.1 Gene:WHRN / 25861 HGNCID:16361 Length:918 Species:Homo sapiens


Alignment Length:157 Identity:39/157 - (24%)
Similarity:67/157 - (42%) Gaps:31/157 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STP-TSPKTPTPPTLPPGVTKTCHIVKRPDFDGYGFNLH-SEKVKPGQFIGKVDADSPAEAAGLK 64
            :|| ..|....|.:..||..:...:.:....:|.||::. ..:...|.::..|:..|.||..||:
Human   119 TTPYRQPAWGGPDSAGPGEVRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLR 183

  Fly    65 EGDRILEVNGVSIGSETHKQVVARIKAIANEVRLLL--------------------IDVDGKALE 109
            .||:||.||..|:...||.:.|   ||:....:|:|                    :|..|::: 
Human   184 VGDQILRVNDKSLARVTHAEAV---KALKGSKKLVLSVYSAGRIPGGYVTNHIYTWVDPQGRSI- 244

  Fly   110 VKPASPPAAACNGNGSASQNGYEGTKQ 136
                |||:.....:|.|.:. .||.::
Human   245 ----SPPSGLPQPHGGALRQ-QEGDRR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 24/101 (24%)
WHRNXP_011516787.1 HN_L-whirlin_R1_like 37..112 CDD:259822
PDZ_signaling 138..215 CDD:238492 22/79 (28%)
PDZ_signaling 277..357 CDD:238492
HN_L-whirlin_R2_like 419..499 CDD:259823
PDZ_signaling 827..898 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.