DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Synj2bp

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_079568.1 Gene:Synj2bp / 24071 MGIID:1344347 Length:145 Species:Mus musculus


Alignment Length:100 Identity:28/100 - (28%)
Similarity:47/100 - (47%) Gaps:14/100 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GYGFNL----HSEKVK--PGQFIGKVDADSPAEAAG-LKEGDRILEVNGVSIGSETHKQVVARIK 90
            |.|||:    ..:.|.  .|.::.::..|..|...| |:|||:||.|||..:.:..|:..|...:
Mouse    22 GLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAAQDGRLQEGDKILSVNGQDLKNLLHQDAVDLFR 86

  Fly    91 ----AIANEVRLLLIDVDGKAL---EVKPASPPAA 118
                |::..|:..|...:|..:   |.:|:..|.|
Mouse    87 NAGCAVSLRVQHRLPVQNGPIVHRGEGEPSGVPVA 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 22/78 (28%)
Synj2bpNP_079568.1 PDZ_signaling 13..97 CDD:238492 21/74 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.