DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and PDZD2

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_005248326.1 Gene:PDZD2 / 23037 HGNCID:18486 Length:2873 Species:Homo sapiens


Alignment Length:271 Identity:62/271 - (22%)
Similarity:94/271 - (34%) Gaps:71/271 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GYGFNLHSE----KVKPGQFIGKVDAD-SPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIKAI 92
            |.||::...    :.:.|.|:..:..: |.||...|||||.||:|||:.|...|.::.:...|.|
Human   596 GLGFSIAGGRDCIRGQMGIFVKTIFPNGSAAEDGRLKEGDEILDVNGIPIKGLTFQEAIHTFKQI 660

  Fly    93 ANEVRLLLIDVDGKALEVKPASPP-----AAACNGNGSASQNGYEGTKQEMPGASANIS---SIS 149
            .:.:.:|.:.....:..:.|.|.|     :|:.|.|.|.             ||||..|   |.|
Human   661 RSGLFVLTVRTKLVSPSLTPCSTPTHMSRSASPNFNTSG-------------GASAGGSDEGSSS 712

  Fly   150 MVSTKRSSNASSIQSGSTMNASDLDVVDRGIPAVAAPVAITPPPV--------------QNGSKP 200
            .:..|.......|....|:|....  |..||.|....:..:||.:              .|.|:.
Human   713 SLGRKTPGPKDRIVMEVTLNKEPR--VGLGIGACCLALENSPPGIYIHSLAPGSVAKMESNLSRG 775

  Fly   201 SSPINNNT--------------LMSTPPPPSATKAGINNNGSV---------------YNTNGNG 236
            ...:..|:              |...||.|.....|.:.|..|               .:...|.
Human   776 DQILEVNSVNVRHAALSKVHAILSKCPPGPVRLVIGRHPNPKVSEQEMDEVIARSTYQESKEANS 840

  Fly   237 TNGMTTPTTPP 247
            :.|:.||...|
Human   841 SPGLGTPLKSP 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 23/72 (32%)
PDZD2XP_005248326.1 PDZ_signaling 335..416 CDD:238492
PDZ_signaling 589..670 CDD:238492 23/73 (32%)
PDZ_signaling 726..810 CDD:238492 15/85 (18%)
PDZ_signaling 2623..2694 CDD:238492
PDZ 2785..2867 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.