Sequence 1: | NP_524712.1 | Gene: | CG10939 / 44155 | FlyBaseID: | FBgn0010620 | Length: | 296 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_620249.1 | Gene: | Tamalin / 192254 | RGDID: | 70554 | Length: | 394 | Species: | Rattus norvegicus |
Alignment Length: | 267 | Identity: | 52/267 - (19%) |
---|---|---|---|
Similarity: | 98/267 - (36%) | Gaps: | 71/267 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 VKRPDFDGYGFNLHS--------EKVKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIGSETH 82
Fly 83 KQVVARIKAIANEVRLLLI---DVDGKALEVKPASPPAAACNGNGSASQNGYEGTKQEMPGASAN 144
Fly 145 ISSISMVSTKRSSNASSIQSGSTMNASD--------LDVVDRGIPAVAAPVAITPPPVQNGSKPS 201
Fly 202 SPINNNTLMST-------------PPPPS-----------------ATKAGINNNGSVYNTNGNG 236
Fly 237 TNGMTTP 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10939 | NP_524712.1 | PDZ_signaling | 20..101 | CDD:238492 | 26/82 (32%) |
Tamalin | NP_620249.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..51 | ||
PDZ_signaling | 99..184 | CDD:238492 | 25/80 (31%) | ||
Interaction with PSCD3. /evidence=ECO:0000250 | 180..257 | 11/96 (11%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 293..318 | 4/24 (17%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |