DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and C46H11.6

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_491502.1 Gene:C46H11.6 / 183523 WormBaseID:WBGene00016730 Length:342 Species:Caenorhabditis elegans


Alignment Length:234 Identity:53/234 - (22%)
Similarity:78/234 - (33%) Gaps:49/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FNLHSEKV-KPGQFIGKVDADSPAEAA-------GLKEGDRILEVNGVS----------IGSETH 82
            |.:..:.| ||...:.:::.:|.....       ||...|:|::|||.|          :..||.
 Worm    34 FKIDEKDVGKPANEVIRINENSMVSFLSTNSFYNGLILSDKIVKVNGASGNISKYQTELMKGETC 98

  Fly    83 KQVVARIKAIANEVR--------LLLIDVDGKALEVKPASPPAAACNGNGSASQNGYEGTKQEMP 139
            ...|.|.|.|....|        :|..|.....:||:..|...:|        ..|...|..:..
 Worm    99 SVEVTRRKNIIPATRERLKKSGCVLRRDNTCFVIEVEKTSAMKSA--------TVGVTVTYIQKR 155

  Fly   140 GASANI--SSISMVSTKRSSNASSIQSGSTMNASDLDVVDR----GIPAVAAPVAITPPPVQNGS 198
            |....|  ||::.:...|......|...|.:||...|...|    ||........:...||   |
 Worm   156 GIVTRIEPSSLASIFFGRGDLIMDINEESILNAEKNDDFIREKLSGILKGEKVTFLVERPV---S 217

  Fly   199 KPSSPINNNTLMSTPPPPSATKA------GINNNGSVYN 231
            ..|:....:.:.|..|.|....|      |.|.:...||
 Worm   218 VESANTLRHLIESVAPDPDVKMANDAICIGRNASNMHYN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 21/90 (23%)
C46H11.6NP_491502.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.