DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and lin-7

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001122664.2 Gene:lin-7 / 175089 WormBaseID:WBGene00002996 Length:209 Species:Caenorhabditis elegans


Alignment Length:79 Identity:26/79 - (32%)
Similarity:46/79 - (58%) Gaps:3/79 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IVKRPDFD-GYGFNLHSEKVKPGQ-FIGKVDADSPAEA-AGLKEGDRILEVNGVSIGSETHKQVV 86
            ||:.|..| |.|||:...|.:... :|.::.....|:. .|||.||:::.||||::.:|.|::.|
 Worm    92 IVELPKTDQGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLIAVNGVNVEAECHEKAV 156

  Fly    87 ARIKAIANEVRLLL 100
            ..:|:....|:|::
 Worm   157 DLLKSAVGSVKLVI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 26/79 (33%)
lin-7NP_001122664.2 L27 13..61 CDD:280918
PDZ_signaling 90..171 CDD:238492 26/79 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.