DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Pdzd3

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_573489.2 Gene:Pdzd3 / 170761 MGIID:2429554 Length:498 Species:Mus musculus


Alignment Length:242 Identity:63/242 - (26%)
Similarity:99/242 - (40%) Gaps:57/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PGVTKTCHIVKRPDFDGYGFNLHSEK---VKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIG 78
            |...:..:|.|.|  :|:||.|..||   .:.|||:..||...||:.||:|.|||::.|.|.|:.
Mouse   258 PAKPRCLNIEKGP--EGFGFLLREEKGLDGRLGQFLWDVDPGLPADKAGMKAGDRLVAVAGESVD 320

  Fly    79 SETHKQVVARIKAIANEVRLLLIDVDG----KALEVKP---------ASPPAAACNG---NGSAS 127
            ...|::.|:||:|..:.|.|:::|.:.    ..:.:.|         |:||.|....   ..:..
Mouse   321 GLGHEETVSRIRAQGSCVSLIVVDPEADRFFSMVRLSPLLFLENTEIAAPPLAETKDLPVEDTVE 385

  Fly   128 QNGYEGTKQ----EMPG----------ASANISSISMVSTKRSSNASSIQSGSTMNASDLDVVDR 178
            .:|..|:.|    ..||          ||.....||.|:...|:..:.:|.|.|:    |:|  .
Mouse   386 PSGLAGSCQCFLYPGPGGGYGFRLCCVASGPCLFISQVTPGGSAARAGLQVGDTV----LEV--N 444

  Fly   179 GIPAVAAPVAITPPPVQNGSKPSSPINNNTLMSTPPPPSATKAGINN 225
            |.|...                .|.::....::...||...|.|..|
Mouse   445 GYPVGG----------------DSELDRLQQLTEAEPPLCLKLGARN 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 32/83 (39%)
Pdzd3NP_573489.2 PDZ_signaling 47..127 CDD:238492
PDZ_signaling 155..232 CDD:238492
PDZ 260..345 CDD:214570 32/86 (37%)
PDZ_signaling 407..471 CDD:238492 16/85 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D377274at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42750
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.