DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Lnx1

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001153049.1 Gene:Lnx1 / 16924 MGIID:1278335 Length:728 Species:Mus musculus


Alignment Length:158 Identity:37/158 - (23%)
Similarity:64/158 - (40%) Gaps:12/158 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 HIV--KRPDFDGYGFNLHSEKVKPGQFIGKVDADSPAEAAG-LKEGDRILEVNGVSIGSETHKQV 85
            |::  |....:..|..|.....:||.||..|.....|:..| |:|.||:|.:||..:...:.:..
Mouse   385 HVILNKSSPEEQLGIKLVRRVDEPGVFIFNVLNGGVADRHGQLEENDRVLAINGHDLRFGSPESA 449

  Fly    86 VARIKAIANEVRLLLIDVDGKALEVKPASP---PAAACNGNGSASQNGYEGTKQEMPGASANISS 147
            ...|:|....|.|::      :.:|:.:||   ..|....||..|....|......|.|:.:...
Mouse   450 AHLIQASERRVHLVV------SRQVRQSSPDIFQEAGWISNGQQSPGPGERNTASKPAATCHEKV 508

  Fly   148 ISMVSTKRSSNASSIQSGSTMNASDLDV 175
            :|:......|...::..|::....||.:
Mouse   509 VSVWKDPSESLGMTVGGGASHREWDLPI 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 22/79 (28%)
Lnx1NP_001153049.1 mRING-HC-C3HC3D_LNX1 42..83 CDD:319693
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..220
NPXY motif 185..188
Interaction with MAGEB18. /evidence=ECO:0000250 186..244
PDZ_signaling 276..360 CDD:238492
PDZ_signaling 384..464 CDD:238492 22/78 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 481..500 4/18 (22%)
PDZ_signaling 506..589 CDD:238492 5/31 (16%)
PDZ_signaling 637..721 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.