DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and PARD3B

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_011508854.1 Gene:PARD3B / 117583 HGNCID:14446 Length:1213 Species:Homo sapiens


Alignment Length:393 Identity:76/393 - (19%)
Similarity:130/393 - (33%) Gaps:132/393 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TPTSPK---TPTPPTLPPGVTKTCHIVKRPDFDGYGFNLHSEKVK-------PGQFIGKVDADSP 57
            :|..|:   .|:.|:|.|             ..|:|.|.:::|:|       .|.....|..||.
Human   360 SPRVPRLGGKPSSPSLSP-------------LMGFGSNKNAKKIKIDLKKGPEGLGFTVVTRDSS 411

  Fly    58 AEAAG------------------LKEGDRILEVNGVSIGSETHKQVVARIKAI--ANEVRLLLID 102
            ....|                  |:.|||||||||..:...|.:::||.:::.  .....|::..
Human   412 IHGPGPIFVKNILPKGAAIKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETASLVIAR 476

  Fly   103 VDGKAL--EVKPASPPAAA--------------CNGNGSASQN-GYEGTKQEMPGASANISSISM 150
            .:|..|  |:| ..|...|              .|.:|||... ..:|.|....|....|...|:
Human   477 QEGHFLPRELK-GEPDCCALSLETSEQLTFEIPLNDSGSAGLGVSLKGNKSRETGTDLGIFIKSI 540

  Fly   151 V---------STKRSSNASSIQSGSTMNASDLDVVD------------RG---IPAVAAPVAITP 191
            :         ..:.:....::...|.:..|:.:.::            ||   :..:..|.....
Human   541 IHGGAAFKDGRLRMNDQLIAVNGESLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPME 605

  Fly   192 PPVQNG--SKP----------SSPINNNTL---MSTPPPPSATKAGINNNGSVYNTNGNGTNGMT 241
            .|.:.|  |||          :|..|:|::   :.|..|....|..:..|           :|..
Human   606 DPAECGAFSKPCFENCQNAVTTSRRNDNSILHPLGTCSPQDKQKGLLLPN-----------DGWA 659

  Fly   242 TPTTPPPPTSGYKAG--------------TLHLPMTAAEMRAKLASKKKYDPKNESVDLK--KKF 290
            ....||.||.....|              .::.|......|:...:::.     ||::||  |..
Human   660 ESEVPPSPTPHSALGLGLEDYSHSSGVDSAVYFPDQHINFRSVTPARQP-----ESINLKASKSM 719

  Fly   291 DII 293
            |::
Human   720 DLV 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 24/107 (22%)
PARD3BXP_011508854.1 DUF3534 <44..151 CDD:288873
PDZ_signaling 209..296 CDD:238492
PDZ_signaling 395..475 CDD:238492 19/79 (24%)
PDZ_signaling 509..597 CDD:238492 13/87 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.