DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and Slc9a3r2

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_446263.2 Gene:Slc9a3r2 / 116501 RGDID:620380 Length:337 Species:Rattus norvegicus


Alignment Length:359 Identity:97/359 - (27%)
Similarity:146/359 - (40%) Gaps:107/359 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PPTLPPGVTKTCHIVKRPDFDGYGFNLHSEKVKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVS 76
            |.:|.|   :.|.:|:..  .||||:||.||.:.||||.:|:..||||||.|:.|||::|||||:
  Rat     4 PESLRP---RLCRLVRGE--QGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVN 63

  Fly    77 IGSETHKQVVARIKAIANEVRLLLIDVD-------------------GKALEVKPASP-PAAACN 121
            :..|||.|||.||||:..:.:||::|.:                   |......|..| |..||:
  Rat    64 VEGETHHQVVQRIKAVEGQTQLLVVDKETDEELCRRQLTCTEEMAHRGLPPAHNPWEPKPDWACS 128

  Fly   122 GN-GS-ASQNGYEGTKQEM---------------------------------PGASANISSISMV 151
            |: || ..|....|..:|:                                 ||:.|::|.:...
  Rat   129 GSLGSDTGQKDVNGPPRELRPRLCHLRRGPQGYGFNLHSDKSRPGQYIRSVDPGSPASLSGLRAQ 193

  Fly   152 STKRSSNASSIQS----------GSTMNASDLDVVD----------RGIPA---VAAPVAITPPP 193
            ......|..:::.          .:..:.:.|.|||          |.:|.   |..|:   |.|
  Rat   194 DRLIEVNGQNVEGLRHAEVVARIKAQEDEARLLVVDPETDEHFKRLRVVPTEDHVEGPL---PSP 255

  Fly   194 VQNGSKPSSPINNNTLMSTPPPPSATKAGINNNGSVYNTNGNGTNGMTTPTTPPPPTSGYKAGTL 258
            |.||:..:.....:...|....|.:.|.  |.:||.:..:             |...||     |
  Rat   256 VTNGTSLAQLNGGSVCSSRSDLPGSEKD--NEDGSAWKRD-------------PFQESG-----L 300

  Fly   259 HLPMTAAEMRAKLASKKKYDPKNESVDLKKKFDI 292
            ||..||||.:.| |...:.:.:...:|..:|.:|
  Rat   301 HLSPTAAEAKEK-ARATRVNKRAPQMDWNRKREI 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 42/80 (53%)
Slc9a3r2NP_446263.2 PDZ_signaling 9..88 CDD:238492 43/83 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..146 6/18 (33%)
PDZ_signaling 149..228 CDD:238492 6/78 (8%)
EBP50_C 232..337 CDD:401087 30/126 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..337 28/112 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351290
Domainoid 1 1.000 86 1.000 Domainoid score I7917
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D377274at33208
OrthoFinder 1 1.000 - - FOG0002256
OrthoInspector 1 1.000 - - otm44813
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2561
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.