powered by:
Protein Alignment CG10939 and USH1C
DIOPT Version :9
Sequence 1: | NP_524712.1 |
Gene: | CG10939 / 44155 |
FlyBaseID: | FBgn0010620 |
Length: | 296 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016872564.1 |
Gene: | USH1C / 10083 |
HGNCID: | 12597 |
Length: | 956 |
Species: | Homo sapiens |
Alignment Length: | 77 |
Identity: | 26/77 - (33%) |
Similarity: | 43/77 - (55%) |
Gaps: | 2/77 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 GYGFNLHSEKV-KPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIKAIANEV 96
|.|.::.|..: |||.||..|...|.:...||:.||:|:|||||...:..||:.|..:|: :..:
Human 221 GLGCSISSGPIQKPGIFISHVKPGSLSAEVGLEIGDQIVEVNGVDFSNLDHKEAVNVLKS-SRSL 284
Fly 97 RLLLIDVDGKAL 108
.:.::...|:.|
Human 285 TISIVAAAGREL 296
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10939 | NP_524712.1 |
PDZ_signaling |
20..101 |
CDD:238492 |
24/68 (35%) |
USH1C | XP_016872564.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.