DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and cytip

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_003199223.2 Gene:cytip / 100537036 ZFINID:ZDB-GENE-140106-76 Length:343 Species:Danio rerio


Alignment Length:311 Identity:65/311 - (20%)
Similarity:124/311 - (39%) Gaps:94/311 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KTCHIVKRPDFDGYGFNL--------HSEKVKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSI 77
            :|..::::.|.:.:||.:        ::..|:...|:.:|...|.||.|||..||.||.||||||
Zfish    76 RTMVVLEKQDNEVFGFEVQTYGLKVKNTSMVEMCTFVCRVQDGSAAETAGLTAGDIILSVNGVSI 140

  Fly    78 GSETHKQVVARIKAIANEVRLLLIDVDG---KALEVKPASPPAAACNGNGSASQNGYEGTKQEMP 139
            ...||:.::..|:..:|.::  |..|.|   |.:|:                 :......||.:.
Zfish   141 EGSTHQNIIELIRESSNTLK--LETVSGSVMKRIEL-----------------EKKMHYLKQTLR 186

  Fly   140 GASANISSISMVSTKRSSNASSIQSGSTMNASDLDVVDRGIPAVAAPVAITPPPVQNGSKPSSPI 204
            .....:.|::: ..||.:..:..:|...:             :|.:.::::.|..::|.:.||..
Zfish   187 EKWVELQSLTL-KEKRLTQGNLNESAQYL-------------SVDSVMSLSSPMGRSGQRFSSDS 237

  Fly   205 NNNTLM----------------STPPPPSATKAGINNNGSVY--------------NTNGNGTNG 239
            :..::|                |:|..|      |.::||.:              :.:..|:|.
Zfish   238 SCRSIMTDDSEDGAFMSSVFDDSSPLSP------IESSGSFFQLEVGALRPITRTRSISLTGSNS 296

  Fly   240 MTTPTTPPPPTSGYKAGTLHLPMTAAEMRAKLASKKKYDPK-----NESVD 285
            ..:|.....|:|.:  |||       ..|::..|.:|:..|     |.||:
Zfish   297 SLSPGWETSPSSLF--GTL-------PRRSRKGSVRKHLLKFIPGLNHSVE 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 27/87 (31%)
cytipXP_003199223.2 PDZ_signaling 78..162 CDD:238492 26/85 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.