powered by:
Protein Alignment CG10939 and SYNJ2BP-COX16
DIOPT Version :9
Sequence 1: | NP_524712.1 |
Gene: | CG10939 / 44155 |
FlyBaseID: | FBgn0010620 |
Length: | 296 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189476.1 |
Gene: | SYNJ2BP-COX16 / 100529257 |
HGNCID: | 48350 |
Length: | 191 |
Species: | Homo sapiens |
Alignment Length: | 61 |
Identity: | 19/61 - (31%) |
Similarity: | 31/61 - (50%) |
Gaps: | 7/61 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 GYGFNL----HSEKVK--PGQFIGKVDADSPAEAAG-LKEGDRILEVNGVSIGSETHKQVV 86
|.|||: ..:.|. .|.::.::..:..|...| |:|||:||.|||..:.:..|:..|
Human 22 GLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAV 82
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.