DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and pdzd3

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_002935063.2 Gene:pdzd3 / 100489736 XenbaseID:XB-GENE-486153 Length:428 Species:Xenopus tropicalis


Alignment Length:91 Identity:38/91 - (41%)
Similarity:54/91 - (59%) Gaps:4/91 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PGVTKTCHIVKRPDFDGYGFNLHSEK--VKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIGS 79
            |..|:..|:||.|  .||||.|..||  ...|||:.::|...|||.||::||||:|.|||.|:..
 Frog   275 PYRTRKLHLVKGP--QGYGFLLRQEKCLAGQGQFLREIDPGLPAEDAGMREGDRLLGVNGQSVEG 337

  Fly    80 ETHKQVVARIKAIANEVRLLLIDVDG 105
            ..|:..|:.|:....:|.|::|..:|
 Frog   338 LEHEDTVSMIQESGKQVTLIVISNEG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 35/82 (43%)
pdzd3XP_002935063.2 PDZ_signaling 61..140 CDD:238492
PDZ_signaling 175..249 CDD:238492
PDZ_signaling 278..359 CDD:238492 35/82 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D377274at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47856
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.