DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10939 and slc9a3r1b

DIOPT Version :9

Sequence 1:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_005174596.1 Gene:slc9a3r1b / 100329719 ZFINID:ZDB-GENE-170530-6 Length:373 Species:Danio rerio


Alignment Length:307 Identity:83/307 - (27%)
Similarity:124/307 - (40%) Gaps:102/307 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPTSPKTPTPPTLPPGVTKTCHIVKRPDFDGYGFNLHSEKVKPGQFIGKVDADSPAEAAGLKE 65
            :|:.|..|....|.|       |.|:|  ..:|:||||||||.:|||||..||.|||||.:||:.
Zfish   158 VSSDTDLKLELRPRL-------CFIMK--GSNGFGFNLHSEKSRPGQFIRAVDEDSPAERSGLRP 213

  Fly    66 GDRILEVNGVSIGSETHKQVVARIKAIANEVRLLLIDVDGKALEVKPASPPAAACNGNGSASQNG 130
            .|||::|||||:..:.|.|||:.|||...|..||::|.|..|...|....|              
Zfish   214 KDRIVQVNGVSVEGKQHAQVVSAIKAGGEETSLLVVDPDTDAFFKKCRVTP-------------- 264

  Fly   131 YEGTKQEMPGASANISSISMVSTKRSSNASSIQSGSTMNASDLDVVDRGIPAVAAPVAITPPPVQ 195
               |.:.:.|                                             |:   |.|:.
Zfish   265 ---TAEHLTG---------------------------------------------PL---PEPLL 278

  Fly   196 NGSKPSSPINNN-------TLMSTPPPPSATKAGINNNGSVYNTNGNGTNGMTTPTTPPPPTSGY 253
            ||.. ...:|.|       :.:|..|.||:..:         ||:      :|||.|..||....
Zfish   279 NGDM-DDKVNGNRDVELKESKLSVSPSPSSASS---------NTS------LTTPPTETPPPEAV 327

  Fly   254 KAGTL----HLPMTAAEMRAKLASKKKYDPKNESVDLKKKFDIIQKL 296
            :|..:    .|.::..:::.: |.:|:.:.:...:|..||.::...|
Zfish   328 EASIMAAIPELSLSLQQVKER-AHQKRCNKRAPPMDWSKKNELFSNL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 44/80 (55%)
slc9a3r1bXP_005174596.1 PDZ_signaling 8..87 CDD:238492
DegQ <137..227 CDD:223343 39/77 (51%)
PDZ 169..252 CDD:214570 47/91 (52%)
EBP50_C 253..373 CDD:286142 31/201 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8709
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D377274at33208
OrthoFinder 1 1.000 - - FOG0002256
OrthoInspector 1 1.000 - - otm26228
orthoMCL 1 0.900 - - OOG6_106590
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5127
SonicParanoid 1 1.000 - - X2561
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.