DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmgs and hmgcs1

DIOPT Version :9

Sequence 1:NP_001286488.1 Gene:Hmgs / 44154 FlyBaseID:FBgn0010611 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001120172.1 Gene:hmgcs1 / 100145212 XenbaseID:XB-GENE-942074 Length:520 Species:Xenopus tropicalis


Alignment Length:466 Identity:296/466 - (63%)
Similarity:360/466 - (77%) Gaps:5/466 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SHWPENVGIRAIEILFPSQYVDQTELETFDGASAGKYTIGLGQAKMGFCSDREDVNSLCLTVVSR 67
            |.||::|||.|:||.||||||||.|||.|||.|||||||||||.||||||||||:||||||||.|
 Frog    11 SSWPKDVGIVALEIYFPSQYVDQVELEKFDGVSAGKYTIGLGQCKMGFCSDREDINSLCLTVVQR 75

  Fly    68 LLERQHVKHSEIGRLEVGTETIVDKSKSVKSVLMQLFAESGNTDIEGIDTTNACYGGTAALFNAV 132
            |:||.::.:..|||||||||||:|||||||:||||||.:|||||:||||||||||||||||||||
 Frog    76 LMERNNLSYDCIGRLEVGTETIIDKSKSVKTVLMQLFEDSGNTDVEGIDTTNACYGGTAALFNAV 140

  Fly   133 NWVESSSWDGRLALAVCADIAVYAKGAARPTGGAGAVAMLVGPNAPLILDRGLRATHMEHAYDFY 197
            |||||||||||.||.|..||||||.|:||||||||||||||||||.|:.:||||.|||:||||||
 Frog   141 NWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLVGPNATLVFERGLRGTHMQHAYDFY 205

  Fly   198 KPDLSSEYPTVDGKLSIQCYLSALDTCYRLYRKKFDQQ-QKDTSKQPASLSTFDAILFHTPFCKL 261
            |||:.||||.|||||||||||||||.||..||||...| ||:.:.:|.:|:.|..::||:|:|||
 Frog   206 KPDMESEYPVVDGKLSIQCYLSALDHCYTTYRKKIHAQWQKEGTDKPFTLNDFGFMIFHSPYCKL 270

  Fly   262 VQKSVGRLSFNDFLLSSEEE-RTKQFPDLERFNTATLESTYFDRDVEKAFMTQSANIFASKTKKS 325
            ||||:.||..|||:..|:.: .:..:..|:.|....||.|||||||||||:..|..:|..|||.|
 Frog   271 VQKSLARLLVNDFISDSDPDMESGMYVGLDSFRDLKLEETYFDRDVEKAFLKASTELFNDKTKAS 335

  Fly   326 LLLANQVGNMYTPSVYSGLVSLLISGPAQELVGKRIGLFSYGSGLAASMYSISVTQDA---AAFE 387
            ||::.:.|||||||||..|.|:|.....|:|.|:|||:||||||.||:|||:.|:|||   ::.:
 Frog   336 LLVSRENGNMYTPSVYGCLASVLAQYSPQQLAGQRIGVFSYGSGFAATMYSLRVSQDAMPGSSLD 400

  Fly   388 KFVSQLDYVQPLLNSREKVAPEQFSALMEVREKNNHAAPYTPTGSISALFPGTYYLKDVDALHRR 452
            |..|.|..::..|:||:.|:|..|:..|::|:..:|.|.|.|.||:..|||||:||..||..|||
 Frog   401 KLTSSLSDLKARLDSRKNVSPSNFADTMKLRQDTHHLANYIPQGSVDDLFPGTWYLVRVDEKHRR 465

  Fly   453 TYERTPTISNG 463
            .|.|:..:::|
 Frog   466 FYARSSLMNDG 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgsNP_001286488.1 HMG-CoA-S_euk 5..456 CDD:273826 293/455 (64%)
cond_enzymes 8..178 CDD:299129 140/169 (83%)
HMG_CoA_synt_C 179..456 CDD:285711 150/281 (53%)
hmgcs1NP_001120172.1 HMG-CoA-S_euk 13..469 CDD:273826 293/455 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1609
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D193643at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2149
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.